SCOPe 2.08: Domain d4nhzc1: 4nhz C:2-103

Lineage for d4nhzc1 (4nhz C:2-103)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Bradyrhizobium sp. [TaxId:288000] [227810] (2 PDB entries)

8. Domain d4nhzc1: 4nhz C:2-103 [235783]
   Other proteins in same PDB: d4nhza2, d4nhzb2, d4nhzb3, d4nhzc2, d4nhzd2, d4nhze2, d4nhzf2, d4nhzg2, d4nhzh2, d4nhzh3, d4nhzi2, d4nhzj2, d4nhzk2, d4nhzl2, d4nhzm2, d4nhzn2, d4nhzo2, d4nhzp2
   automated match to d4mf7a1
   complexed with gsh

Details for d4nhzc1

PDB Entry: 4nhz, 1.9 Å

PDB Description: crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., target efi-507290, with one glutathione bound

PDB Compounds: (C:) Putative glutathione S-transferase enzyme with thioredoxin-like domain

SCOPe Domain Sequences for d4nhzc1:

Sequence; same for both SEQRES and ATOM records:

>d4nhzc1 c.47.1.0 (C:2-103) automated matches {Bradyrhizobium sp. [TaxId: 288000]}
sdlssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpe
flslnpngkipaiidpngpgdkplglfesgailqylaektgq

Timeline for d4nhzc1:

• d4nhzc1 first appeared in SCOPe 2.03
  
• d4nhzc1 appears in SCOPe 2.07