Lineage for d1tmf3_ (1tmf 3:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 proteins)
  6. 11837Protein Theiler's murine encephalomyelitis virus [49686] (1 species)
  7. 11838Species Theiler's murine encephalomyelitis virus, strain da [TaxId:12124] [49687] (2 PDB entries)
  8. 11844Domain d1tmf3_: 1tmf 3: [23578]

Details for d1tmf3_

PDB Entry: 1tmf (more details), 3.5 Å

PDB Description: three-dimensional structure of theiler murine encephalomyelitis virus (bean strain)

SCOP Domain Sequences for d1tmf3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmf3_ b.10.1.4 (3:) Theiler's murine encephalomyelitis virus {Theiler's murine encephalomyelitis virus, strain da}
spipvtvrehkgcfystnpdttvpiygktistpsdymcgefsdllelcklptflgnpntn
nkrypyfsatnsvpatsmvdyqvalscscmansmlaavarnfnqyrgslnflfvftgaam
vkgkfliaytppgagkpttrdqamqstyaiwdlglnssfnftapfispthyrqtsytspt
itsvdgwvtvwqltpltypsgtptnsdiltlvsagddftlrmpisptkwvpq

SCOP Domain Coordinates for d1tmf3_:

Click to download the PDB-style file with coordinates for d1tmf3_.
(The format of our PDB-style files is described here.)

Timeline for d1tmf3_: