Class b: All beta proteins [48724] (93 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) |
Protein Theiler's murine encephalomyelitis virus [49686] (1 species) |
Species Theiler's murine encephalomyelitis virus, strain da [TaxId:12124] [49687] (2 PDB entries) |
Domain d1tmf3_: 1tmf 3: [23578] |
PDB Entry: 1tmf (more details), 3.5 Å
SCOP Domain Sequences for d1tmf3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tmf3_ b.10.1.4 (3:) Theiler's murine encephalomyelitis virus {Theiler's murine encephalomyelitis virus, strain da} spipvtvrehkgcfystnpdttvpiygktistpsdymcgefsdllelcklptflgnpntn nkrypyfsatnsvpatsmvdyqvalscscmansmlaavarnfnqyrgslnflfvftgaam vkgkfliaytppgagkpttrdqamqstyaiwdlglnssfnftapfispthyrqtsytspt itsvdgwvtvwqltpltypsgtptnsdiltlvsagddftlrmpisptkwvpq
Timeline for d1tmf3_: