Lineage for d4nhze1 (4nhz E:4-104)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879289Species Bradyrhizobium sp. [TaxId:288000] [227810] (2 PDB entries)
  8. 2879295Domain d4nhze1: 4nhz E:4-104 [235777]
    Other proteins in same PDB: d4nhza2, d4nhzb2, d4nhzb3, d4nhzc2, d4nhzd2, d4nhze2, d4nhzf2, d4nhzg2, d4nhzh2, d4nhzh3, d4nhzi2, d4nhzj2, d4nhzk2, d4nhzl2, d4nhzm2, d4nhzn2, d4nhzo2, d4nhzp2
    automated match to d4mf7a1
    complexed with gsh

Details for d4nhze1

PDB Entry: 4nhz (more details), 1.9 Å

PDB Description: crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., target efi-507290, with one glutathione bound
PDB Compounds: (E:) Putative glutathione S-transferase enzyme with thioredoxin-like domain

SCOPe Domain Sequences for d4nhze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nhze1 c.47.1.0 (E:4-104) automated matches {Bradyrhizobium sp. [TaxId: 288000]}
dlssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpef
lslnpngkipaiidpngpgdkplglfesgailqylaektgq

SCOPe Domain Coordinates for d4nhze1:

Click to download the PDB-style file with coordinates for d4nhze1.
(The format of our PDB-style files is described here.)

Timeline for d4nhze1: