SCOPe 2.05: Domain d4nekf_: 4nek F:

Lineage for d4nekf_ (4nek F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (49 species)
   not a true protein

7. Species Magnetospirillum magneticum [TaxId:342108] [226647] (2 PDB entries)

8. Domain d4nekf_: 4nek F: [235769]
   automated match to d4neke_
   complexed with peg

Details for d4nekf_

PDB Entry: 4nek, 2.3 Å

PDB Description: putative enoyl-coa hydratase/carnithine racemase from magnetospirillum magneticum amb-1

PDB Compounds: (F:) Enoyl-CoA hydratase/carnithine racemase

SCOPe Domain Sequences for d4nekf_:

Sequence; same for both SEQRES and ATOM records:

>d4nekf_ c.14.1.0 (F:) automated matches {Magnetospirillum magneticum [TaxId: 342108]}
mselvlshveggvqvvrmnrpdkknaligemyaalaeafakgeadddvnvflilgsqtdf
sagndlpdfltwealsgsvadrfiravagarkpvvaavrgaaigigstllphcdlvyaap
gtrfhmpfinlgivpeagssqtmpalaghrraaemlmlgepfgvdtaeavglingvvpge
dleetamaaarklaakprsilvqikalmktpaepimdrltreaavfdtclkgealneavs
afkekrapdfsk

Timeline for d4nekf_:

• d4nekf_ first appeared in SCOPe 2.03
  
• d4nekf_ appears in SCOPe 2.04
  
• d4nekf_ appears in SCOPe 2.06
  
• d4nekf_ appears in the current release, SCOPe 2.08