SCOPe 2.03: Domain d4nekc_: 4nek C:

Lineage for d4nekc_ (4nek C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (42 species)
   not a true protein

7. Species Magnetospirillum magneticum [TaxId:342108] [226647] (2 PDB entries)

8. Domain d4nekc_: 4nek C: [235767]
   automated match to d4neke_
   complexed with peg

Details for d4nekc_

PDB Entry: 4nek, 2.3 Å

PDB Description: putative enoyl-coa hydratase/carnithine racemase from magnetospirillum magneticum amb-1

PDB Compounds: (C:) Enoyl-CoA hydratase/carnithine racemase

SCOPe Domain Sequences for d4nekc_:

Sequence; same for both SEQRES and ATOM records:

>d4nekc_ c.14.1.0 (C:) automated matches {Magnetospirillum magneticum [TaxId: 342108]}
mselvlshveggvqvvrmnrpdkknaligemyaalaeafakgeadddvnvflilgsqtdf
sagndlpdfltwealsgsvadrfiravagarkpvvaavrgaaigigstllphcdlvyaap
gtrfhmpfinlgivpeagssqtmpalaghrraaemlmlgepfgvdtaeavglingvvpge
dleetamaaarklaakprsilvqikalmktpaepimdrltreaavfdtclkgealneavs
afkekrapdfsk

Timeline for d4nekc_:

• d4nekc_ is new in SCOPe 2.03-stable
  
• d4nekc_ appears in SCOPe 2.04
  
• d4nekc_ appears in the current release, SCOPe 2.08