Lineage for d4neka_ (4nek A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1585212Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1585213Protein automated matches [190246] (46 species)
    not a true protein
  7. 1585416Species Magnetospirillum magneticum [TaxId:342108] [226647] (2 PDB entries)
  8. 1585418Domain d4neka_: 4nek A: [235766]
    automated match to d4neke_
    complexed with peg

Details for d4neka_

PDB Entry: 4nek (more details), 2.3 Å

PDB Description: putative enoyl-coa hydratase/carnithine racemase from magnetospirillum magneticum amb-1
PDB Compounds: (A:) Enoyl-CoA hydratase/carnithine racemase

SCOPe Domain Sequences for d4neka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4neka_ c.14.1.0 (A:) automated matches {Magnetospirillum magneticum [TaxId: 342108]}
selvlshveggvqvvrmnrpdkknaligemyaalaeafakgeadddvnvflilgsqtdfs
agndlpdfltwealsgsvadrfiravagarkpvvaavrgaaigigstllphcdlvyaapg
trfhmpfinlgivpeagssqtmpalaghrraaemlmlgepfgvdtaeavglingvvpged
leetamaaarklaakprsilvqikalmktpaepimdrltreaavfdtclkgealneavsa
fkekrapdfsk

SCOPe Domain Coordinates for d4neka_:

Click to download the PDB-style file with coordinates for d4neka_.
(The format of our PDB-style files is described here.)

Timeline for d4neka_: