Lineage for d4nega_ (4neg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (32 species)
    not a true protein
  7. 2140092Species Bacillus anthracis [TaxId:261594] [229005] (1 PDB entry)
  8. 2140093Domain d4nega_: 4neg A: [235764]
    automated match to d4negb_
    complexed with fmt, gol, so4

Details for d4nega_

PDB Entry: 4neg (more details), 2.2 Å

PDB Description: The crystal structure of tryptophan synthase subunit beta from Bacillus anthracis str. 'Ames Ancestor'
PDB Compounds: (A:) tryptophan synthase beta chain

SCOPe Domain Sequences for d4nega_:

Sequence, based on SEQRES records: (download)

>d4nega_ c.79.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}
vpetlmqsvleleeaykeamedeafqkelnhylktyvgretplyfaenmteycggakiyl
kredlnhtgahkinntigqallavrmgkkkvvaetgagqhgvatatvcallglecvifmg
eedvrrqklnvfrmellgakvesvaagsgtlkdavnealrywvshvhdthyimgsvlgph
pfpqivrdfqsvignetkkqyealegklpeavvacigggsnamgmfypfvhdeevalygv
eaagkgvhtekhaatltkgsvgvlhgsmmyllqneegqiqeahsisagldypgvgpehsl
lkdigrvsyhsitddealeafqlltkkegiipalesshavayalklapqmkedeglvicl
sgrgdkdvesikrym

Sequence, based on observed residues (ATOM records): (download)

>d4nega_ c.79.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}
vpetlmqsvleleeaykeamedeafqkelnhylktyvgretplyfaenmteycggakiyl
kredlnhtgahkinntigqallavrmgkkkvvaetgagqhgvatatvcallglecvifmg
eedvrrqklnvfrmellgakvesvaagtlkdavnealrywvshvhdthyimgsvlgphpf
pqivrdfqsvignetkkqyealegklpeavvacigggsnamgmfypfvhdeevalygvea
agdyhsllkdigrvsyhsitddealeafqlltkkegiipalesshavayalklapqmked
eglviclsgrgdkdvesikrym

SCOPe Domain Coordinates for d4nega_:

Click to download the PDB-style file with coordinates for d4nega_.
(The format of our PDB-style files is described here.)

Timeline for d4nega_: