Lineage for d4nbwc_ (4nbw C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1581208Species Plesiocystis pacifica [TaxId:391625] [229449] (1 PDB entry)
  8. 1581211Domain d4nbwc_: 4nbw C: [235762]
    automated match to d4nbwa_
    complexed with nad

Details for d4nbwc_

PDB Entry: 4nbw (more details), 2 Å

PDB Description: Crystal structure of FabG from Plesiocystis pacifica
PDB Compounds: (C:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d4nbwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nbwc_ c.2.1.0 (C:) automated matches {Plesiocystis pacifica [TaxId: 391625]}
krvaiitgaangigratalefaqagyhvvawdlaeeagaaliaeiadaggsadfarvdvs
aaesveaavaeiiaehgrvdvlvnnagilhdgqlvkvkggevvkkmaeaqfdavisvnlk
gvflctqavaphmiaakygrilnassvvglygnfgqtnyvaaksgvigmtkvwarelgry
gitvnaiapgfiatemvqqmpervleamvartpvgrigdpvdiaraylflaseesgfisg
ttlsvdggmvvgs

SCOPe Domain Coordinates for d4nbwc_:

Click to download the PDB-style file with coordinates for d4nbwc_.
(The format of our PDB-style files is described here.)

Timeline for d4nbwc_: