Lineage for d4nbuc_ (4nbu C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350096Species Bacillus sp. [TaxId:161544] [229451] (1 PDB entry)
  8. 1350099Domain d4nbuc_: 4nbu C: [235758]
    automated match to d4nbud_
    complexed with caa, nai

Details for d4nbuc_

PDB Entry: 4nbu (more details), 1.34 Å

PDB Description: Crystal structure of FabG from Bacillus sp
PDB Compounds: (C:) 3-oxoacyl-(acyl-carrier-protein) reductase

SCOPe Domain Sequences for d4nbuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nbuc_ c.2.1.0 (C:) automated matches {Bacillus sp. [TaxId: 161544]}
srlqdkvaiitgaangigleaarvfmkegakvviadfneaagkeaveanpgvvfirvdvs
dresvhrlvenvaerfgkidilinnagitrdsmlskmtvdqfqqvinvnltgvfhctqav
lpymaeqgkgkiintssvtgtygnvgqtnyaaakagvigmtktwakelarkginvnavap
gftetamvaevpekviekmkaqvpmgrlgkpedianaylflashesdyvnghvlhvdggi
mm

SCOPe Domain Coordinates for d4nbuc_:

Click to download the PDB-style file with coordinates for d4nbuc_.
(The format of our PDB-style files is described here.)

Timeline for d4nbuc_: