SCOPe 2.08: Domain d4naxb1: 4nax B:2-103

Lineage for d4naxb1 (4nax B:2-103)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:351746] [228879] (1 PDB entry)

8. Domain d4naxb1: 4nax B:2-103 [235754]
   Other proteins in same PDB: d4naxa2, d4naxa3, d4naxb2
   automated match to d4naxa1
   complexed with fmt, gds, gol

Details for d4naxb1

PDB Entry: 4nax, 1.3 Å

PDB Description: crystal structure of glutathione transferase pput_1760 from pseudomonas putida, target efi-507288, with one glutathione disulfide bound per one protein subunit

PDB Compounds: (B:) Glutathione S-transferase, N-terminal domain protein

SCOPe Domain Sequences for d4naxb1:

Sequence; same for both SEQRES and ATOM records:

>d4naxb1 c.47.1.0 (B:2-103) automated matches {Pseudomonas putida [TaxId: 351746]}
telsafpitrkwpakhperlqlyslptpngvkvsimleeiglayeahkvsfdnddqlspe
fislsannkipaildpngpggqplplfesgailqylaeksgq

Timeline for d4naxb1:

• d4naxb1 first appeared in SCOPe 2.03
  
• d4naxb1 appears in SCOPe 2.07