| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Pseudomonas putida [TaxId:351746] [228879] (1 PDB entry) |
| Domain d4naxb1: 4nax B:2-103 [235754] Other proteins in same PDB: d4naxa2, d4naxa3, d4naxb2 automated match to d4naxa1 complexed with fmt, gds, gol |
PDB Entry: 4nax (more details), 1.3 Å
SCOPe Domain Sequences for d4naxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4naxb1 c.47.1.0 (B:2-103) automated matches {Pseudomonas putida [TaxId: 351746]}
telsafpitrkwpakhperlqlyslptpngvkvsimleeiglayeahkvsfdnddqlspe
fislsannkipaildpngpggqplplfesgailqylaeksgq
Timeline for d4naxb1: