SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4nasc1 (4nas C:10-122)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2175267Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2175463Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2175464Protein automated matches [226983] (13 species)
    not a true protein
  7. 2175465Species Alicyclobacillus acidocaldarius [TaxId:521098] [228997] (1 PDB entry)
  8. 2175468Domain d4nasc1: 4nas C:10-122 [235749]
    Other proteins in same PDB: d4nasa2, d4nasb2, d4nasc2, d4nasd2
    automated match to d4nasa1
    complexed with ca, cl, fmt, gol

Details for d4nasc1

PDB Entry: 4nas (more details), 1.92 Å

PDB Description: The crystal structure of a rubisco-like protein (MtnW) from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
PDB Compounds: (C:) Ribulose-bisphosphate carboxylase

SCOPe Domain Sequences for d4nasc1:

Sequence, based on SEQRES records: (download)

>d4nasc1 d.58.9.0 (C:10-122) automated matches {Alicyclobacillus acidocaldarius [TaxId: 521098]}
davvatyrlrdrkdklearaegiavgltigtwtdlpaarksevakhcgrvegirvlderp
dgdvvaeidiaypvanlngtfasllvtvfgklsmdgeirlerlqmpdelvrqf

Sequence, based on observed residues (ATOM records): (download)

>d4nasc1 d.58.9.0 (C:10-122) automated matches {Alicyclobacillus acidocaldarius [TaxId: 521098]}
davvatyrlrdrkdklearaegiavgltigtwpaarksevakhcgrvegirvlderpdgd
vvaeidiaypvanlngtfasllvtvfgklsmdgeirlerlqmpdelvrqf

SCOPe Domain Coordinates for d4nasc1:

Click to download the PDB-style file with coordinates for d4nasc1.
(The format of our PDB-style files is described here.)

Timeline for d4nasc1: