Lineage for d4nasb1 (4nas B:10-122)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953000Species Alicyclobacillus acidocaldarius [TaxId:521098] [228997] (1 PDB entry)
  8. 2953002Domain d4nasb1: 4nas B:10-122 [235747]
    Other proteins in same PDB: d4nasa2, d4nasb2, d4nasc2, d4nasd2
    automated match to d4nasa1
    complexed with ca, cl, fmt, gol

Details for d4nasb1

PDB Entry: 4nas (more details), 1.92 Å

PDB Description: The crystal structure of a rubisco-like protein (MtnW) from Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
PDB Compounds: (B:) Ribulose-bisphosphate carboxylase

SCOPe Domain Sequences for d4nasb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nasb1 d.58.9.0 (B:10-122) automated matches {Alicyclobacillus acidocaldarius [TaxId: 521098]}
davvatyrlrdrkdklearaegiavgltigtwtdlpaarksevakhcgrvegirvlderp
dgdvvaeidiaypvanlngtfasllvtvfgklsmdgeirlerlqmpdelvrqf

SCOPe Domain Coordinates for d4nasb1:

Click to download the PDB-style file with coordinates for d4nasb1.
(The format of our PDB-style files is described here.)

Timeline for d4nasb1: