SCOPe 2.08: Domain d4n5la_: 4n5l A:

Lineage for d4n5la_ (4n5l A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Ralstonia eutropha [TaxId:381666] [229715] (8 PDB entries)

8. Domain d4n5la_: 4n5l A: [235738]
   automated match to d4n5ma_

Details for d4n5la_

PDB Entry: 4n5l, 1.65 Å

PDB Description: Crystal structure of (R)-3-hydroxybutyryl-CoA dehydrogenase from Ralstonia eutropha

PDB Compounds: (A:) Acetoacetyl-CoA reductase

SCOPe Domain Sequences for d4n5la_:

Sequence; same for both SEQRES and ATOM records:

>d4n5la_ c.2.1.0 (A:) automated matches {Ralstonia eutropha [TaxId: 381666]}
qriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqkalgfdfiasegnv
adwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavidtnltslfnvtkq
vidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaqevatkgvtvntvs
pgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlsseesgfstgadfslngg
lhmg

Timeline for d4n5la_:

• d4n5la_ first appeared in SCOPe 2.03
  
• d4n5la_ appears in SCOPe 2.07