SCOPe 2.07: Domain d4n38a_: 4n38 A:

Lineage for d4n38a_ (4n38 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)

8. Domain d4n38a_: 4n38 A: [235733]
   automated match to d4n36b_
   complexed with ca, gal, mg, nag

Details for d4n38a_

PDB Entry: 4n38, 2 Å

PDB Description: structure of langerin crd i313 d288 complexed with glcnac-beta1-3gal- beta1-4glcnac-beta-ch2ch2n3

PDB Compounds: (A:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d4n38a_:

Sequence; same for both SEQRES and ATOM records:

>d4n38a_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
agmegdwswvddtpfnkvqsarfwipgepndagnnehcgnikapslqawndapcditflf
ickrpyvp

Timeline for d4n38a_:

• d4n38a_ first appeared in SCOPe 2.03
  
• d4n38a_ appears in SCOPe 2.06
  
• d4n38a_ appears in the current release, SCOPe 2.08