SCOP 1.59: Domain d1tme1_: 1tme 1:

Lineage for d1tme1_ (1tme 1:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.4: Animal virus proteins [49656] (16 proteins)

6. Protein Theiler's murine encephalomyelitis virus [49686] (1 species)

7. Species Theiler's murine encephalomyelitis virus, strain da [TaxId:12124] [49687] (2 PDB entries)

8. Domain d1tme1_: 1tme 1: [23573]

Details for d1tme1_

PDB Entry: 1tme, 2.8 Å

PDB Description: three-dimensional structure of theiler virus

SCOP Domain Sequences for d1tme1_:

Sequence; same for both SEQRES and ATOM records:

>d1tme1_ b.10.1.4 (1:) Theiler's murine encephalomyelitis virus {Theiler's murine encephalomyelitis virus, strain da}
gsdnaekgkvsnddasvdfvaepvklpenqtrvaffydravpigmlrpgqniestfvyqe
ndlrlncllltplpsfcpdstsgpvktkapvqwrwvrsggttnfplmtkqdyaflcfspf
tyykcdlevtvsalgtdtvasvlrwaptgapadvtdqligytpslgetrnphmwlvgagn
tqisfvvpynsplsvlpaawfngwsdfgntkdfgvapnadfgrlwiqgntsasvrirykk
mkvfcprptlffpwpv

Timeline for d1tme1_:

• d1tme1_ first appeared (with stable ids) in SCOP 1.55
  
• d1tme1_ appears in SCOP 1.57
  
• d1tme1_ appears in SCOP 1.61
  
• d1tme1_ appears in the current release, SCOPe 2.08