![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
![]() | Protein automated matches [190159] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186882] (56 PDB entries) |
![]() | Domain d4n36a_: 4n36 A: [235726] automated match to d4n36b_ complexed with 2f8, ca, mg |
PDB Entry: 4n36 (more details), 1.85 Å
SCOPe Domain Sequences for d4n36a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n36a_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk agmegdwswvddtpfnkvqsarfwipgepndagnnehcgnikapslqawndapcditflf ickrpyvp
Timeline for d4n36a_: