Lineage for d4n2yd_ (4n2y D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090271Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2091023Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2091024Protein automated matches [190292] (34 species)
    not a true protein
  7. 2091061Species Archaeoglobus fulgidus [TaxId:2234] [228125] (2 PDB entries)
  8. 2091067Domain d4n2yd_: 4n2y D: [235721]
    automated match to d4muza_
    complexed with gol

Details for d4n2yd_

PDB Entry: 4n2y (more details), 1.55 Å

PDB Description: Crystal structure of orotidine 5'-monophosphate decarboxylase from Archaeoglobus fulgidus
PDB Compounds: (D:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d4n2yd_:

Sequence, based on SEQRES records: (download)

>d4n2yd_ c.1.2.0 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkqlilaldvmdgekameiakkvaehvdrikvnyplvlsagvgimkrlseikpviadfki
advpytssliariafensaesvivhgfvgsdtlrevcrvaeefggkvyavtelsspggee
fmsavslkivekakeagchgliapstrierlreirkaagdmeilcpgigaqkgsieavky
adgiivgrgiyasgnpaeearklrrvlki

Sequence, based on observed residues (ATOM records): (download)

>d4n2yd_ c.1.2.0 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkqlilaldvmdgekameiakkvaehvdrikvnyplvlsagvgimkrlseikpviadfki
advpytssliariafensaesvivhgfvgsdtlrevcrvaeefggkvyavtelsspggee
fmsavslkivekakeagchgliapstrierlreirkaagdmeilcpsieavkyadgiivg
rgiyasgnpaeearklrrvlki

SCOPe Domain Coordinates for d4n2yd_:

Click to download the PDB-style file with coordinates for d4n2yd_.
(The format of our PDB-style files is described here.)

Timeline for d4n2yd_: