SCOPe 2.04: Domain d4n34b_: 4n34 B:

Lineage for d4n34b_ (4n34 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries)

8. Domain d4n34b_: 4n34 B: [235717]
   automated match to d4n34a_
   complexed with 2f8, ca

Details for d4n34b_

PDB Entry: 4n34, 1.75 Å

PDB Description: structure of langerin crd i313 with alpha-meglcnac

PDB Compounds: (B:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d4n34b_:

Sequence; same for both SEQRES and ATOM records:

>d4n34b_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
agmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcditflf
ickrpyvp

Timeline for d4n34b_:

• d4n34b_ first appeared in SCOPe 2.03
  
• d4n34b_ appears in SCOPe 2.05
  
• d4n34b_ appears in the current release, SCOPe 2.08