![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
![]() | Protein automated matches [190646] (77 species) not a true protein |
![]() | Species Brucella melitensis [TaxId:224914] [228825] (1 PDB entry) |
![]() | Domain d4n0qc_: 4n0q C: [235711] automated match to d4n0qa_ complexed with leu |
PDB Entry: 4n0q (more details), 2.3 Å
SCOPe Domain Sequences for d4n0qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n0qc_ c.93.1.0 (C:) automated matches {Brucella melitensis [TaxId: 224914]} ditigviapltgpvaafgdqvkkgaetavevinkaggikgekvvlkfaddagepkqgvsa anqivgdgikfvvglvttgvavpvsdvlsengvlmvtptatgpdltarglenvfrtcgrd gqqaevmadyvlknmkdkkvavihdkgaygkgladafkaainkggitevhydsvtpgdkd fsalvtklksagaevvyfggyhaeggllsrqlhdagmqalvlggeglsnteywaiggtna qgtlftnakdatknpaakdaiqalkaknipaeaftmnayaavevikagieragstddsaa vakalhdgkpietaigtltysetgdlsspsfdifkwddgkivgl
Timeline for d4n0qc_: