Lineage for d4n0qc_ (4n0q C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913315Species Brucella melitensis [TaxId:224914] [228825] (1 PDB entry)
  8. 2913318Domain d4n0qc_: 4n0q C: [235711]
    automated match to d4n0qa_
    complexed with leu

Details for d4n0qc_

PDB Entry: 4n0q (more details), 2.3 Å

PDB Description: crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
PDB Compounds: (C:) Leu/Ile/Val-binding protein homolog 3

SCOPe Domain Sequences for d4n0qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n0qc_ c.93.1.0 (C:) automated matches {Brucella melitensis [TaxId: 224914]}
ditigviapltgpvaafgdqvkkgaetavevinkaggikgekvvlkfaddagepkqgvsa
anqivgdgikfvvglvttgvavpvsdvlsengvlmvtptatgpdltarglenvfrtcgrd
gqqaevmadyvlknmkdkkvavihdkgaygkgladafkaainkggitevhydsvtpgdkd
fsalvtklksagaevvyfggyhaeggllsrqlhdagmqalvlggeglsnteywaiggtna
qgtlftnakdatknpaakdaiqalkaknipaeaftmnayaavevikagieragstddsaa
vakalhdgkpietaigtltysetgdlsspsfdifkwddgkivgl

SCOPe Domain Coordinates for d4n0qc_:

Click to download the PDB-style file with coordinates for d4n0qc_.
(The format of our PDB-style files is described here.)

Timeline for d4n0qc_: