Class b: All beta proteins [48724] (110 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.4: Animal virus proteins [49656] (16 proteins) |
Protein Echovirus type 1 [49684] (1 species) |
Species Host: human (Homo sapiens) [49685] (1 PDB entry) |
Domain d1ev12_: 1ev1 2: [23571] |
PDB Entry: 1ev1 (more details), 3.55 Å
SCOP Domain Sequences for d1ev12_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ev12_ b.10.1.4 (2:) Echovirus type 1 {Host: human (Homo sapiens)} gysdrvrsitlgnstittqecanvvvgygewpeylsdneataedqptqpdvatcrfytld svqwengspgwwwkfpdalrdmglfgqnmyyhylgragytihvqcnaskfhqgcilvvcv peaemgsaqtsgvvnyehiskgeiasrftttttaedhgvqaavwnagmgvgvgnltifph qwinlrtnnsativmpyvnsvpmdnmyrhhnftlmiipfvpldfsagastyvpitvtvap mcaeynglrlaghq
Timeline for d1ev12_: