Lineage for d1ev12_ (1ev1 2:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107303Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 107304Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 107416Family b.10.1.4: Animal virus proteins [49656] (16 proteins)
  6. 107437Protein Echovirus type 1 [49684] (1 species)
  7. 107438Species Host: human (Homo sapiens) [49685] (1 PDB entry)
  8. 107440Domain d1ev12_: 1ev1 2: [23571]

Details for d1ev12_

PDB Entry: 1ev1 (more details), 3.55 Å

PDB Description: echovirus 1

SCOP Domain Sequences for d1ev12_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ev12_ b.10.1.4 (2:) Echovirus type 1 {Host: human (Homo sapiens)}
gysdrvrsitlgnstittqecanvvvgygewpeylsdneataedqptqpdvatcrfytld
svqwengspgwwwkfpdalrdmglfgqnmyyhylgragytihvqcnaskfhqgcilvvcv
peaemgsaqtsgvvnyehiskgeiasrftttttaedhgvqaavwnagmgvgvgnltifph
qwinlrtnnsativmpyvnsvpmdnmyrhhnftlmiipfvpldfsagastyvpitvtvap
mcaeynglrlaghq

SCOP Domain Coordinates for d1ev12_:

Click to download the PDB-style file with coordinates for d1ev12_.
(The format of our PDB-style files is described here.)

Timeline for d1ev12_: