Lineage for d4mzaa_ (4mza A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065266Protein automated matches [193245] (14 species)
    not a true protein
  7. 2065270Species Human parainfluenza 3 virus [TaxId:11217] [228816] (2 PDB entries)
  8. 2065271Domain d4mzaa_: 4mza A: [235707]
    automated match to d4mzab_
    complexed with ca, edo, nag, po4, so4

Details for d4mzaa_

PDB Entry: 4mza (more details), 1.65 Å

PDB Description: crystal structure of hpiv3 hemagglutinin-neuraminidase
PDB Compounds: (A:) hemagglutinin-neuraminidase

SCOPe Domain Sequences for d4mzaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mzaa_ b.68.1.1 (A:) automated matches {Human parainfluenza 3 virus [TaxId: 11217]}
rithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvind
liyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslal
lntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyp
svgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvns
iivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiidit
dysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqk
srvnpvityststervnelairnktlsagytttscithynkgycfhiveinhksldtfqp
mlfkteipkscs

SCOPe Domain Coordinates for d4mzaa_:

Click to download the PDB-style file with coordinates for d4mzaa_.
(The format of our PDB-style files is described here.)

Timeline for d4mzaa_: