SCOPe 2.05: Domain d4myob_: 4myo B:

Lineage for d4myob_ (4myo B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
   this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain

6. Protein automated matches [190704] (4 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [193357] (3 PDB entries)

8. Domain d4myob_: 4myo B: [235703]
   automated match to d4myoa_
   complexed with cl, mg, so4

Details for d4myob_

PDB Entry: 4myo, 2.7 Å

PDB Description: Crystal structure of streptogramin group A antibiotic acetyltransferase VatA from Staphylococcus aureus

PDB Compounds: (B:) Virginiamycin A acetyltransferase

SCOPe Domain Sequences for d4myob_:

Sequence; same for both SEQRES and ATOM records:

>d4myob_ b.81.1.3 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ghgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdk
liigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndv
wigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalq
wwnldmkiinenlpfiingdiemlkrkrklld

Timeline for d4myob_:

• d4myob_ first appeared in SCOPe 2.03
  
• d4myob_ appears in SCOPe 2.04
  
• d4myob_ is called d4myob1 in SCOPe 2.06
  
• d4myob_ appears in the current release, SCOPe 2.08, called d4myob1