Lineage for d4myka_ (4myk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115323Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 protein domains)
    Pfam PF00491
  6. 2115567Protein automated matches [190112] (3 species)
    not a true protein
  7. 2115594Species Trypanosoma cruzi [TaxId:5693] [229336] (4 PDB entries)
  8. 2115596Domain d4myka_: 4myk A: [235700]
    automated match to d4mxrb_
    complexed with mn

Details for d4myka_

PDB Entry: 4myk (more details), 1.52 Å

PDB Description: Crystal structure of Trypanosoma cruzi formiminoglutamase (oxidized) with Mn2+2 at pH 8.5
PDB Compounds: (A:) Formiminoglutamase

SCOPe Domain Sequences for d4myka_:

Sequence, based on SEQRES records: (download)

>d4myka_ c.42.1.1 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
tddprllslfsaqreedadiviigfpydegcvrnggragakkgpaafrfflqrlgsvnnl
elnvdashlklydagditastleeahekleskvftvlargafpfvigggndqsapngram
lrafpgdvgvinvdshldvrpplsdgrvhsgtpfrqlleessfsgkrfvefacqgsqcga
lhaqyvrdhqghlmwlsevrkkgavaaledafgltgkntffsfdvdslkssdmpgvscpa
avglsaqeafdmcflagktptvmmmdmselnplveeyrsprvavymfyhfvlgfatrp

Sequence, based on observed residues (ATOM records): (download)

>d4myka_ c.42.1.1 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
tddprllslfsaqreedadiviigfpydegcvrnggragakkgpaafrfflqrlgsvnnl
elnvdashlklydagditastleeahekleskvftvlargafpfvigggndqsapngram
lrafpgdvgvinvdshldvrgtpfrqlleessfsgkrfvefacqgsqcgalhaqyvrdhq
ghlmwlsevrkkgavaaledafgltgkntffsfdvdslkssdmpgvscpaavglsaqeaf
dmcflagktptvmmmdmselnplveeyrsprvavymfyhfvlgfatrp

SCOPe Domain Coordinates for d4myka_:

Click to download the PDB-style file with coordinates for d4myka_.
(The format of our PDB-style files is described here.)

Timeline for d4myka_: