Lineage for d1ev11_ (1ev1 1:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1141359Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1141532Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1141533Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 1141553Protein Human enterovirus B coat proteins [88635] (4 species)
  7. 1141563Species Human echovirus 1 [TaxId:46633] [49685] (1 PDB entry)
  8. 1141565Domain d1ev11_: 1ev1 1: [23570]
    complexed with myr, plm

Details for d1ev11_

PDB Entry: 1ev1 (more details), 3.55 Å

PDB Description: echovirus 1
PDB Compounds: (1:) echovirus 1

SCOPe Domain Sequences for d1ev11_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ev11_ b.121.4.1 (1:) Human enterovirus B coat proteins {Human echovirus 1 [TaxId: 46633]}
gdvqnavegamvrvadtvqtsatnservpnltavetghtsqavpgdtmqtrhvinnhvrs
estienflarsacvfyleyktgtkedsnsfnnwvittrrvaqlrrklemftylrfdmeit
vvitssqdqstsqnqnapvlthqimyvppggpipvsvddyswqtstnpsifwtegnapar
msipfisignaysnfydgwshfsqagvygfttlnnmgqlffrhvnkpnpaaitsvariyf
kpkhvrawvprpprlcpyinstnvnfepkpvtevrtniitt

SCOPe Domain Coordinates for d1ev11_:

Click to download the PDB-style file with coordinates for d1ev11_.
(The format of our PDB-style files is described here.)

Timeline for d1ev11_: