Lineage for d4mwfl2 (4mwf L:108-213)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (733 PDB entries)
  8. 2353467Domain d4mwfl2: 4mwf L:108-213 [235697]
    Other proteins in same PDB: d4mwfb1, d4mwfl1
    automated match to d4mwfb2
    complexed with bma, man, nag

Details for d4mwfl2

PDB Entry: 4mwf (more details), 2.65 Å

PDB Description: structure of hepatitis c virus envelope glycoprotein e2 core bound to broadly neutralizing antibody ar3c
PDB Compounds: (L:) Fab AR3C light chain

SCOPe Domain Sequences for d4mwfl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mwfl2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d4mwfl2:

Click to download the PDB-style file with coordinates for d4mwfl2.
(The format of our PDB-style files is described here.)

Timeline for d4mwfl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mwfl1