SCOPe 2.05: Domain d4mwfl1: 4mwf L:2-107

Lineage for d4mwfl1 (4mwf L:2-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)

8. Domain d4mwfl1: 4mwf L:2-107 [235696]
   Other proteins in same PDB: d4mwfb2, d4mwfl2
   automated match to d4mwfb1
   complexed with nag

Details for d4mwfl1

PDB Entry: 4mwf, 2.65 Å

PDB Description: structure of hepatitis c virus envelope glycoprotein e2 core bound to broadly neutralizing antibody ar3c

PDB Compounds: (L:) Fab AR3C light chain

SCOPe Domain Sequences for d4mwfl1:

Sequence; same for both SEQRES and ATOM records:

>d4mwfl1 b.1.1.1 (L:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieltqspatlsvspgeratlscrasqsvssnlawyqqkpgqaprlliygastratgipar
fsgsgsgteftltvsrlepedsavyfcqqyyrspltfgggtkveik

Timeline for d4mwfl1:

• d4mwfl1 first appeared in SCOPe 2.03
  
• d4mwfl1 appears in SCOPe 2.04
  
• d4mwfl1 appears in SCOPe 2.06
  
• d4mwfl1 appears in the current release, SCOPe 2.08