SCOPe 2.03: Domain d4mxif_: 4mxi F:

Lineage for d4mxif_ (4mxi F:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
   automatically mapped to Pfam PF00574

6. Protein automated matches [190149] (7 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [189958] (4 PDB entries)

8. Domain d4mxif_: 4mxi F: [235693]
   automated match to d4mxid_

Details for d4mxif_

PDB Entry: 4mxi, 2.3 Å

PDB Description: ClpP Ser98dhA

PDB Compounds: (F:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d4mxif_:

Sequence, based on SEQRES records:

>d4mxif_ c.14.1.1 (F:) automated matches {Staphylococcus aureus [TaxId: 93061]}
ydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfai
ydtiqhikpdvqticigmaaamgsfllaagakgkrfalpnaevmihqplggaqgqateie
iaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp

Sequence, based on observed residues (ATOM records):

>d4mxif_ c.14.1.1 (F:) automated matches {Staphylococcus aureus [TaxId: 93061]}
ydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfai
ydtiqhikpdvqticigmaaamgsfllaagakgkrfalpnaevmihqplqateieiaanh
ilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp

Timeline for d4mxif_:

• d4mxif_ is new in SCOPe 2.03-stable
  
• d4mxif_ appears in SCOPe 2.04
  
• d4mxif_ appears in the current release, SCOPe 2.08