Lineage for d4mxig_ (4mxi G:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099100Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 protein domains)
    automatically mapped to Pfam PF00574
  6. 2099280Protein automated matches [190149] (9 species)
    not a true protein
  7. 2099439Species Staphylococcus aureus [TaxId:93061] [189958] (6 PDB entries)
  8. 2099474Domain d4mxig_: 4mxi G: [235692]
    automated match to d4mxid_

Details for d4mxig_

PDB Entry: 4mxi (more details), 2.3 Å

PDB Description: ClpP Ser98dhA
PDB Compounds: (G:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d4mxig_:

Sequence, based on SEQRES records: (download)

>d4mxig_ c.14.1.1 (G:) automated matches {Staphylococcus aureus [TaxId: 93061]}
ydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfai
ydtiqhikpdvqticigmaaamgsfllaagakgkrfalpnaevmihqplggaqgqateie
iaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvpe

Sequence, based on observed residues (ATOM records): (download)

>d4mxig_ c.14.1.1 (G:) automated matches {Staphylococcus aureus [TaxId: 93061]}
ydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfai
ydtiqhikpdvqticigmaaamgsfllaagakgkrfalpnaevmihqplqateieiaanh
ilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvpe

SCOPe Domain Coordinates for d4mxig_:

Click to download the PDB-style file with coordinates for d4mxig_.
(The format of our PDB-style files is described here.)

Timeline for d4mxig_: