SCOPe 2.06: Domain d4mxib_: 4mxi B:

Lineage for d4mxib_ (4mxi B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
   automatically mapped to Pfam PF00574

6. Protein automated matches [190149] (9 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [189958] (6 PDB entries)

8. Domain d4mxib_: 4mxi B: [235691]
   automated match to d4mxid_

Details for d4mxib_

PDB Entry: 4mxi, 2.3 Å

PDB Description: ClpP Ser98dhA

PDB Compounds: (B:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d4mxib_:

Sequence, based on SEQRES records:

>d4mxib_ c.14.1.1 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
diysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfaiy
dtiqhikpdvqticigmaaamgsfllaagakgkrfalpnaevmihqplggaqgqateiei
aanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp

Sequence, based on observed residues (ATOM records):

>d4mxib_ c.14.1.1 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
diysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfaiy
dtiqhikpdvqticigmaaamgsfllaagakgkrfalpnaevmihqpteieiaanhilkt
reklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp

Timeline for d4mxib_:

• d4mxib_ first appeared in SCOPe 2.03
  
• d4mxib_ appears in SCOPe 2.05
  
• d4mxib_ appears in SCOPe 2.07
  
• d4mxib_ appears in the current release, SCOPe 2.08