SCOPe 2.07: Domain d4muwa_: 4muw A:

Lineage for d4muwa_ (4muw A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)

8. Domain d4muwa_: 4muw A: [235689]
   automated match to d3wi2a_
   complexed with 2f4, gol, so4, zn

Details for d4muwa_

PDB Entry: 4muw, 2.64 Å

PDB Description: Crystal Structure of PDE10A with Novel Keto-Benzimidazole Inhibitor

PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4muwa_:

Sequence; same for both SEQRES and ATOM records:

>d4muwa_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrf
imsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfs
nsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaii
atdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltand
iyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepl
lkacrdnlsqwekvirge

Timeline for d4muwa_:

• d4muwa_ first appeared in SCOPe 2.03
  
• d4muwa_ appears in SCOPe 2.06
  
• d4muwa_ appears in the current release, SCOPe 2.08