Lineage for d4mqkb_ (4mqk B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2302148Species Human (Homo sapiens) [TaxId:9606] [188371] (10 PDB entries)
  8. 2302163Domain d4mqkb_: 4mqk B: [235687]
    Other proteins in same PDB: d4mqka_, d4mqkc_, d4mqke_, d4mqkg_
    automated match to d4mqkd_
    complexed with cmo, hem; mutant

Details for d4mqkb_

PDB Entry: 4mqk (more details), 2.24 Å

PDB Description: Carbonmonoxy Structure of the Human Fetal Hemoglobin Mutant HbF Toms River alphawtgammaV67M
PDB Compounds: (B:) Hemoglobin subunit gamma-2

SCOPe Domain Sequences for d4mqkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mqkb_ a.1.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkvk
ahgkkmltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgke
ftpevqaswqkmvtgvasalssryh

SCOPe Domain Coordinates for d4mqkb_:

Click to download the PDB-style file with coordinates for d4mqkb_.
(The format of our PDB-style files is described here.)

Timeline for d4mqkb_: