Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (44 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188371] (10 PDB entries) |
Domain d4mqjd_: 4mqj D: [235684] Other proteins in same PDB: d4mqja_, d4mqjb2, d4mqjc_, d4mqje_, d4mqjf2, d4mqjg_, d4mqjh2 automated match to d4mqjf_ complexed with cmo, hem, oxy |
PDB Entry: 4mqj (more details), 1.8 Å
SCOPe Domain Sequences for d4mqjd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mqjd_ a.1.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkvk ahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgke ftpevqaswqkmvtgvasalssryh
Timeline for d4mqjd_: