Lineage for d4mqjh_ (4mqj H:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717797Protein automated matches [190359] (40 species)
    not a true protein
  7. 1717990Species Human (Homo sapiens) [TaxId:9606] [188371] (5 PDB entries)
  8. 1717996Domain d4mqjh_: 4mqj H: [235683]
    Other proteins in same PDB: d4mqja_, d4mqjc_, d4mqje_, d4mqjg_
    automated match to d4mqjf_
    complexed with cmo, hem, oxy

Details for d4mqjh_

PDB Entry: 4mqj (more details), 1.8 Å

PDB Description: structure of wild-type fetal human hemoglobin hbf
PDB Compounds: (H:) Hemoglobin subunit gamma-2

SCOPe Domain Sequences for d4mqjh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mqjh_ a.1.1.2 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vhfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtgvasalssryh

SCOPe Domain Coordinates for d4mqjh_:

Click to download the PDB-style file with coordinates for d4mqjh_.
(The format of our PDB-style files is described here.)

Timeline for d4mqjh_: