SCOPe 2.08: Domain d4mqjh1: 4mqj H:2-146

Lineage for d4mqjh1 (4mqj H:2-146)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188371] (10 PDB entries)

8. Domain d4mqjh1: 4mqj H:2-146 [235683]
   Other proteins in same PDB: d4mqja_, d4mqjb2, d4mqjc_, d4mqje_, d4mqjf2, d4mqjg_, d4mqjh2
   automated match to d4mqjf_
   complexed with cmo, hem, oxy

Details for d4mqjh1

PDB Entry: 4mqj, 1.8 Å

PDB Description: structure of wild-type fetal human hemoglobin hbf

PDB Compounds: (H:) Hemoglobin subunit gamma-2

SCOPe Domain Sequences for d4mqjh1:

Sequence; same for both SEQRES and ATOM records:

>d4mqjh1 a.1.1.2 (H:2-146) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkvk
ahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgke
ftpevqaswqkmvtgvasalssryh

Timeline for d4mqjh1:

• d4mqjh1 first appeared in SCOPe 2.03, called d4mqjh_
  
• d4mqjh1 appears in SCOPe 2.07