SCOPe 2.07: Domain d4mqjb1: 4mqj B:2-146

Lineage for d4mqjb1 (4mqj B:2-146)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (44 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188371] (10 PDB entries)

8. Domain d4mqjb1: 4mqj B:2-146 [235682]
   Other proteins in same PDB: d4mqja_, d4mqjb2, d4mqjc_, d4mqje_, d4mqjf2, d4mqjg_, d4mqjh2
   automated match to d4mqjf_
   complexed with cmo, hem, oxy

Details for d4mqjb1

PDB Entry: 4mqj, 1.8 Å

PDB Description: structure of wild-type fetal human hemoglobin hbf

PDB Compounds: (B:) Hemoglobin subunit gamma-2

SCOPe Domain Sequences for d4mqjb1:

Sequence; same for both SEQRES and ATOM records:

>d4mqjb1 a.1.1.2 (B:2-146) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkvk
ahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgke
ftpevqaswqkmvtgvasalssryh

Timeline for d4mqjb1:

• d4mqjb1 first appeared in SCOPe 2.03, called d4mqjb_
  
• d4mqjb1 appears in SCOPe 2.06
  
• d4mqjb1 appears in the current release, SCOPe 2.08