Lineage for d4mqjb1 (4mqj B:2-146)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688692Species Human (Homo sapiens) [TaxId:9606] [188371] (10 PDB entries)
  8. 2688703Domain d4mqjb1: 4mqj B:2-146 [235682]
    Other proteins in same PDB: d4mqja_, d4mqjb2, d4mqjc_, d4mqje_, d4mqjf2, d4mqjg_, d4mqjh2
    automated match to d4mqjf_
    complexed with cmo, hem, oxy

Details for d4mqjb1

PDB Entry: 4mqj (more details), 1.8 Å

PDB Description: structure of wild-type fetal human hemoglobin hbf
PDB Compounds: (B:) Hemoglobin subunit gamma-2

SCOPe Domain Sequences for d4mqjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mqjb1 a.1.1.2 (B:2-146) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkvk
ahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgke
ftpevqaswqkmvtgvasalssryh

SCOPe Domain Coordinates for d4mqjb1:

Click to download the PDB-style file with coordinates for d4mqjb1.
(The format of our PDB-style files is described here.)

Timeline for d4mqjb1: