Class b: All beta proteins [48724] (93 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) |
Protein Coxsackievirus A9 [49682] (1 species) |
Species Host: human (Homo sapiens) [49683] (1 PDB entry) |
Domain d1d4m2_: 1d4m 2: [23568] |
PDB Entry: 1d4m (more details), 2.9 Å
SCOP Domain Sequences for d1d4m2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d4m2_ b.10.1.4 (2:) Coxsackievirus A9 {Host: human (Homo sapiens)} sdrvrsitlgnstittqecanvvvgygrwptylrddeataedqptqpdvatcrfytldsi kwekgsvgwwwkfpealsdmglfgqnmqyhylgragytihvqcnaskfhqgcllvvcvpe aemggavvgqafsatamangdkayeftsatqsdqtkvqtaihnagmgvgvgnltiyphqw inlrtnnsativmpyinsvpmdnmfrhynftlmvipfvkldyadtastyvpitvtvapmc aeynglrlaqaq
Timeline for d1d4m2_: