Lineage for d1d4m2_ (1d4m 2:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 proteins)
  6. 11562Protein Coxsackievirus A9 [49682] (1 species)
  7. 11563Species Host: human (Homo sapiens) [49683] (1 PDB entry)
  8. 11565Domain d1d4m2_: 1d4m 2: [23568]

Details for d1d4m2_

PDB Entry: 1d4m (more details), 2.9 Å

PDB Description: the crystal structure of coxsackievirus a9 to 2.9 a resolution

SCOP Domain Sequences for d1d4m2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4m2_ b.10.1.4 (2:) Coxsackievirus A9 {Host: human (Homo sapiens)}
sdrvrsitlgnstittqecanvvvgygrwptylrddeataedqptqpdvatcrfytldsi
kwekgsvgwwwkfpealsdmglfgqnmqyhylgragytihvqcnaskfhqgcllvvcvpe
aemggavvgqafsatamangdkayeftsatqsdqtkvqtaihnagmgvgvgnltiyphqw
inlrtnnsativmpyinsvpmdnmfrhynftlmvipfvkldyadtastyvpitvtvapmc
aeynglrlaqaq

SCOP Domain Coordinates for d1d4m2_:

Click to download the PDB-style file with coordinates for d1d4m2_.
(The format of our PDB-style files is described here.)

Timeline for d1d4m2_: