SCOPe 2.04: Domain d4mqbb_: 4mqb B:

Lineage for d4mqbb_ (4mqb B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [226321] (5 PDB entries)

8. Domain d4mqbb_: 4mqb B: [235679]
   automated match to d4mqba_
   complexed with mes, pg4

Details for d4mqbb_

PDB Entry: 4mqb, 1.55 Å

PDB Description: crystal structure of thymidylate kinase from staphylococcus aureus in complex with 2-(n-morpholino)ethanesulfonic acid

PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d4mqbb_:

Sequence; same for both SEQRES and ATOM records:

>d4mqbb_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikylek

Timeline for d4mqbb_:

• d4mqbb_ first appeared in SCOPe 2.03
  
• d4mqbb_ appears in SCOPe 2.05
  
• d4mqbb_ appears in the current release, SCOPe 2.08