Lineage for d4mmwa2 (4mmw A:127-381)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1823470Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1823572Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 1823762Protein automated matches [226997] (11 species)
    not a true protein
  7. 1823771Species Agrobacterium tumefaciens [TaxId:176299] [226506] (4 PDB entries)
  8. 1823774Domain d4mmwa2: 4mmw A:127-381 [235678]
    Other proteins in same PDB: d4mmwa1, d4mmwb1
    automated match to d4mmwb2
    complexed with cl, llh, mg, pge, xyh

Details for d4mmwa2

PDB Entry: 4mmw (more details), 1.65 Å

PDB Description: Crystal structure of D-glucarate dehydratase from Agrobacterium tumefaciens complexed with magnesium, L-Xylarohydroxamate and L-Lyxarohydroxamate
PDB Compounds: (A:) isomerase/lactonizing enzyme

SCOPe Domain Sequences for d4mmwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mmwa2 c.1.11.2 (A:127-381) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
yrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvswapdvkmd
lkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeqslssykwl
sdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhlaeafgmec
evhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgfvhvpdrpg
lgedidftfidnnrv

SCOPe Domain Coordinates for d4mmwa2:

Click to download the PDB-style file with coordinates for d4mmwa2.
(The format of our PDB-style files is described here.)

Timeline for d4mmwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mmwa1