| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.2: D-glucarate dehydratase-like [51609] (14 proteins) |
| Protein automated matches [226997] (7 species) not a true protein |
| Species Agrobacterium tumefaciens [TaxId:176299] [226506] (4 PDB entries) |
| Domain d4mmwa2: 4mmw A:127-381 [235678] Other proteins in same PDB: d4mmwa1, d4mmwb1 automated match to d4mmwb2 complexed with cl, llh, mg, pge, xyh |
PDB Entry: 4mmw (more details), 1.65 Å
SCOPe Domain Sequences for d4mmwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mmwa2 c.1.11.2 (A:127-381) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
yrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvswapdvkmd
lkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeqslssykwl
sdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhlaeafgmec
evhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgfvhvpdrpg
lgedidftfidnnrv
Timeline for d4mmwa2: