Lineage for d1d4m1_ (1d4m 1:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107303Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 107304Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 107416Family b.10.1.4: Animal virus proteins [49656] (16 proteins)
  6. 107427Protein Coxsackievirus A9 [49682] (1 species)
  7. 107428Species Host: human (Homo sapiens) [49683] (1 PDB entry)
  8. 107429Domain d1d4m1_: 1d4m 1: [23567]

Details for d1d4m1_

PDB Entry: 1d4m (more details), 2.9 Å

PDB Description: the crystal structure of coxsackievirus a9 to 2.9 a resolution

SCOP Domain Sequences for d1d4m1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4m1_ b.10.1.4 (1:) Coxsackievirus A9 {Host: human (Homo sapiens)}
gdveeaieravvhvadtmrsgpsnsasvpaltavetghtsqvtpsdtmqtrhvknyhsrs
estvenflgrsacvymeeykttdndvnkkfvawpintkqmvqmrrklemftylrfdmevt
fvitsrqdpgttlaqdmpvlthqimyvppggpipakvddyawqtstnpsifwtegnapar
msipfisignaysnfydgwsnfdqrgsygyntlnnlghiyvrhvsgssphpitstirvyf
kpkhtrawvprpprlcqykkafsvdftptpitdtrkdintvttv

SCOP Domain Coordinates for d1d4m1_:

Click to download the PDB-style file with coordinates for d1d4m1_.
(The format of our PDB-style files is described here.)

Timeline for d1d4m1_: