Lineage for d4mkvd2 (4mkv D:148-469)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1344774Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 1344775Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 1345026Protein automated matches [226984] (4 species)
    not a true protein
  7. 1345044Species Pea (Pisum sativum) [TaxId:3888] [226514] (2 PDB entries)
  8. 1345048Domain d4mkvd2: 4mkv D:148-469 [235666]
    Other proteins in same PDB: d4mkva1, d4mkvb1, d4mkvc1, d4mkvd1, d4mkvs_, d4mkvt_, d4mkvu_, d4mkvv_
    automated match to d4mkva2
    complexed with a8s, po4, rub

Details for d4mkvd2

PDB Entry: 4mkv (more details), 2.15 Å

PDB Description: structure of pisum sativum rubisco with aba
PDB Compounds: (D:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d4mkvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mkvd2 c.1.14.1 (D:148-469) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaeaiyksqaetgeikghylnatagtceemlkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
agtvvgklegereitlgfvdllrddyikkdrsrgiyftqdwvslpgvipvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregnaiire
ackwspelaaacevwkeikfef

SCOPe Domain Coordinates for d4mkvd2:

Click to download the PDB-style file with coordinates for d4mkvd2.
(The format of our PDB-style files is described here.)

Timeline for d4mkvd2: