Lineage for d4mkvd1 (4mkv D:12-147)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909192Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1909384Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 1909385Protein automated matches [226983] (12 species)
    not a true protein
  7. 1909481Species Pea (Pisum sativum) [TaxId:3888] [226513] (2 PDB entries)
  8. 1909485Domain d4mkvd1: 4mkv D:12-147 [235665]
    Other proteins in same PDB: d4mkva2, d4mkvb2, d4mkvc2, d4mkvd2, d4mkvs_, d4mkvt_, d4mkvu_, d4mkvv_
    automated match to d4mkva1
    complexed with a8s, po4, rub

Details for d4mkvd1

PDB Entry: 4mkv (more details), 2.15 Å

PDB Description: Structure of Pisum sativum Rubisco with ABA
PDB Compounds: (D:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d4mkvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mkvd1 d.58.9.0 (D:12-147) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
dgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsivgnvfgfkalr
alrledlripyayvkt

SCOPe Domain Coordinates for d4mkvd1:

Click to download the PDB-style file with coordinates for d4mkvd1.
(The format of our PDB-style files is described here.)

Timeline for d4mkvd1: