Lineage for d4mkvb1 (4mkv B:12-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953134Species Pea (Pisum sativum) [TaxId:3888] [226513] (2 PDB entries)
  8. 2953140Domain d4mkvb1: 4mkv B:12-147 [235663]
    Other proteins in same PDB: d4mkva2, d4mkvb2, d4mkvc2, d4mkvd2, d4mkvs_, d4mkvt_, d4mkvu_, d4mkvv_
    automated match to d4mkva1
    complexed with a8s, po4, rub

Details for d4mkvb1

PDB Entry: 4mkv (more details), 2.15 Å

PDB Description: structure of pisum sativum rubisco with aba
PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d4mkvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mkvb1 d.58.9.0 (B:12-147) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
dgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsivgnvfgfkalr
alrledlripyayvkt

SCOPe Domain Coordinates for d4mkvb1:

Click to download the PDB-style file with coordinates for d4mkvb1.
(The format of our PDB-style files is described here.)

Timeline for d4mkvb1: