Lineage for d4mkvv_ (4mkv V:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656663Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1656664Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1656665Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1656823Protein automated matches [190066] (5 species)
    not a true protein
  7. 1656892Species Pea (Pisum sativum) [TaxId:3888] [193409] (2 PDB entries)
  8. 1656896Domain d4mkvv_: 4mkv V: [235662]
    Other proteins in same PDB: d4mkva1, d4mkva2, d4mkvb1, d4mkvb2, d4mkvc1, d4mkvc2, d4mkvd1, d4mkvd2
    automated match to d4mkvu_
    complexed with a8s, po4, rub

Details for d4mkvv_

PDB Entry: 4mkv (more details), 2.15 Å

PDB Description: structure of pisum sativum rubisco with aba
PDB Compounds: (V:) Ribulose bisphosphate carboxylase small chain 3A, chloroplastic

SCOPe Domain Sequences for d4mkvv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mkvv_ d.73.1.1 (V:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mqvwppigkkkfetlsylppltrdqllkeveyllrkgwvpclefelkkgfvyrehnkspg
yydgrywtmwklpmfgttdasqvlkeldevkkayprafvriigfdnvrqvqcisfiahtp
agy

SCOPe Domain Coordinates for d4mkvv_:

Click to download the PDB-style file with coordinates for d4mkvv_.
(The format of our PDB-style files is described here.)

Timeline for d4mkvv_: