Lineage for d4mj1d_ (4mj1 D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812227Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1813264Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 1813597Family b.121.6.0: automated matches [227135] (1 protein)
    not a true family
  6. 1813598Protein automated matches [226836] (6 species)
    not a true protein
  7. 1813599Species Bk polyomavirus [TaxId:10629] [228808] (2 PDB entries)
  8. 1813608Domain d4mj1d_: 4mj1 D: [235651]
    automated match to d4mj0b_
    complexed with cl, gol

Details for d4mj1d_

PDB Entry: 4mj1 (more details), 2 Å

PDB Description: unliganded BK Polyomavirus VP1 pentamer
PDB Compounds: (D:) VP1 capsid protein

SCOPe Domain Sequences for d4mj1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mj1d_ b.121.6.0 (D:) automated matches {Bk polyomavirus [TaxId: 10629]}
vevlevktgvdaitevecflnpemgdpdenlrgfslklsaendfssdsperkmlpcysta
riplpnlnedltcgnllmweavtvqtevigitsmlnlhagsqkvhehgggkpiqgsnfhf
favggdplemqgvlmnyrtkypdgtitpknptaqsqvmntdhkayldknnaypvecwvpd
psrnentryfgtftggenvppvlhvtntattvlldeqgvgplckadslyvsaadicglft
nssgtqqwrglaryfkirlrkrsvkn

SCOPe Domain Coordinates for d4mj1d_:

Click to download the PDB-style file with coordinates for d4mj1d_.
(The format of our PDB-style files is described here.)

Timeline for d4mj1d_: