Class b: All beta proteins [48724] (176 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.0: automated matches [227135] (1 protein) not a true family |
Protein automated matches [226836] (6 species) not a true protein |
Species Bk polyomavirus [TaxId:10629] [228808] (2 PDB entries) |
Domain d4mj1d_: 4mj1 D: [235651] automated match to d4mj0b_ complexed with cl, gol |
PDB Entry: 4mj1 (more details), 2 Å
SCOPe Domain Sequences for d4mj1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mj1d_ b.121.6.0 (D:) automated matches {Bk polyomavirus [TaxId: 10629]} vevlevktgvdaitevecflnpemgdpdenlrgfslklsaendfssdsperkmlpcysta riplpnlnedltcgnllmweavtvqtevigitsmlnlhagsqkvhehgggkpiqgsnfhf favggdplemqgvlmnyrtkypdgtitpknptaqsqvmntdhkayldknnaypvecwvpd psrnentryfgtftggenvppvlhvtntattvlldeqgvgplckadslyvsaadicglft nssgtqqwrglaryfkirlrkrsvkn
Timeline for d4mj1d_:
View in 3D Domains from other chains: (mouse over for more information) d4mj1a_, d4mj1b_, d4mj1c_, d4mj1e_ |