Lineage for d4mj1a_ (4mj1 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076457Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2076790Family b.121.6.0: automated matches [227135] (1 protein)
    not a true family
  6. 2076791Protein automated matches [226836] (6 species)
    not a true protein
  7. 2076792Species Bk polyomavirus [TaxId:10629] [228808] (2 PDB entries)
  8. 2076798Domain d4mj1a_: 4mj1 A: [235649]
    automated match to d4mj0b_
    complexed with cl, gol

Details for d4mj1a_

PDB Entry: 4mj1 (more details), 2 Å

PDB Description: unliganded BK Polyomavirus VP1 pentamer
PDB Compounds: (A:) VP1 capsid protein

SCOPe Domain Sequences for d4mj1a_:

Sequence, based on SEQRES records: (download)

>d4mj1a_ b.121.6.0 (A:) automated matches {Bk polyomavirus [TaxId: 10629]}
evlevktgvdaitevecflnpemgdpdenlrgfslklsaendfssdsperkmlpcystar
iplpnlnedltcgnllmweavtvqtevigitsmlnlhagsqkvhehgggkpiqgsnfhff
avggdplemqgvlmnyrtkypdgtitpknptaqsqvmntdhkayldknnaypvecwvpdp
srnentryfgtftggenvppvlhvtntattvlldeqgvgplckadslyvsaadicglftn
ssgtqqwrglaryfkirlrkrsvk

Sequence, based on observed residues (ATOM records): (download)

>d4mj1a_ b.121.6.0 (A:) automated matches {Bk polyomavirus [TaxId: 10629]}
evlevktgvdaitevecflnpemgdpdenlrgfslklsaendfssdsperkmlpcystar
iplpnlnedllmweavtvqtevigitsmlnlhagsqkvhehgggkpiqgsnfhffavggd
plemqgvlmnyrtkypdgtitpknptaqsqvmntdhkayldknnaypvecwvpdpsrnen
tryfgtftggenvppvlhvtntattvlldeqgvgplckadslyvsaadicglftnssgtq
qwrglaryfkirlrkrsvk

SCOPe Domain Coordinates for d4mj1a_:

Click to download the PDB-style file with coordinates for d4mj1a_.
(The format of our PDB-style files is described here.)

Timeline for d4mj1a_: