Lineage for d4mhiq1 (4mhi Q:11-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775757Domain d4mhiq1: 4mhi Q:11-324 [235640]
    Other proteins in same PDB: d4mhia2, d4mhib_, d4mhic2, d4mhid_, d4mhie2, d4mhif_, d4mhig2, d4mhih_, d4mhii2, d4mhij_, d4mhik2, d4mhil_, d4mhim2, d4mhin_, d4mhio2, d4mhip_, d4mhiq2, d4mhir_
    automated match to d4mhie_
    complexed with nag

Details for d4mhiq1

PDB Entry: 4mhi (more details), 2.6 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin from a/goose/guangdong/1/96
PDB Compounds: (Q:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4mhiq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mhiq1 b.19.1.2 (Q:11-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcsvagw
llgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqiipks
swsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrntp

SCOPe Domain Coordinates for d4mhiq1:

Click to download the PDB-style file with coordinates for d4mhiq1.
(The format of our PDB-style files is described here.)

Timeline for d4mhiq1: