Lineage for d4mhio1 (4mhi O:11-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040515Domain d4mhio1: 4mhi O:11-324 [235639]
    Other proteins in same PDB: d4mhia2, d4mhib_, d4mhic2, d4mhid_, d4mhie2, d4mhif_, d4mhig2, d4mhih_, d4mhii2, d4mhij_, d4mhik2, d4mhil_, d4mhim2, d4mhin_, d4mhio2, d4mhip_, d4mhiq2, d4mhir_
    automated match to d4mhie_
    complexed with nag

Details for d4mhio1

PDB Entry: 4mhi (more details), 2.6 Å

PDB Description: Crystal structure of a H5N1 influenza virus hemagglutinin from A/goose/Guangdong/1/96
PDB Compounds: (O:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4mhio1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mhio1 b.19.1.2 (O:11-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilrdcsvagw
llgnpmcdefinvpewsyivekaspandlcypgdfndyeelkhllsrtnhfekiqiipks
swsnhdassgvssacpyhgrssffrnvvwlikknsayptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpeiatrpkvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrntp

SCOPe Domain Coordinates for d4mhio1:

Click to download the PDB-style file with coordinates for d4mhio1.
(The format of our PDB-style files is described here.)

Timeline for d4mhio1: