SCOPe 2.03: Domain d4mhbb_: 4mhb B:

Lineage for d4mhbb_ (4mhb B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein automated matches [190169] (4 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [228396] (1 PDB entry)

8. Domain d4mhbb_: 4mhb B: [235631]
   automated match to d4mhbd_
   complexed with so4

Details for d4mhbb_

PDB Entry: 4mhb, 1.75 Å

PDB Description: Structure of a putative reductase from Yersinia pestis

PDB Compounds: (B:) Putative aldo/keto reductase

SCOPe Domain Sequences for d4mhbb_:

Sequence; same for both SEQRES and ATOM records:

>d4mhbb_ c.1.7.1 (B:) automated matches {Yersinia pestis [TaxId: 632]}
mqtvklnngiampllgfgvfqmtntaeceravidaietgyrlidtaasyqnetqvgnalk
lsgiardelfittklwlqdtyyegakaqferslnrlqldyvdlylihqpygdvhgawram
eelhqagkiraigvsnfhpdrladlmafnkiipavnqievnpfnqqlhavpwmqsrgiqp
eawapfaegrnglfqnpvltaigekygksvgqvvlrwifqrgivslaksvrkgrmeenin
ildfelsaedmlqiaaldtatsaffshrdpamvewltgrkldv

Timeline for d4mhbb_:

• d4mhbb_ is new in SCOPe 2.03-stable
  
• d4mhbb_ appears in SCOPe 2.04
  
• d4mhbb_ appears in the current release, SCOPe 2.08